PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00537.1.g00220.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 659aa    MW: 71675.5 Da    PI: 7.9372
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00537.1.g00220.1.am.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.21.4e-182986457
                                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                                      ++t+eq+e+Le+++ ++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  Zpz_sc00537.1.g00220.1.am.mkhc 29 YVRYTPEQVEALERVYSECPKPSSLRRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 86
                                    6789****************************************************97 PP

2START253.9e-09177234259
                                     HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHH CS
                           START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvla 59 
                                     +aee+++e+++ka+ ++  Wv+++ +++g++++ +++ s+++sg a+ra+g+v  +++
  Zpz_sc00537.1.g00220.1.am.mkhc 177 IAEETLAEFLSKATGTAVDWVQMVGMKPGPDSIGIIAVSHNCSGVAARACGLVSLEPT 234
                                     68999************************************************98775 PP

3START68.51.9e-22236318125204
                                     EEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHT CS
                           START 125 ivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatl 200
                                     i+++S+++ +  p+   ++++vRae+lpSg+li+p+++g+s +++v+hvdl++++++++lr+l++s  + ++k++ a+l
  Zpz_sc00537.1.g00220.1.am.mkhc 236 ICERSLTQSTGGPSgpnTPNFVRAEVLPSGYLIRPCEGGGSMIHIVDHVDLDAWSVPEVLRPLYESPKILAQKMTIAAL 314
                                     899*****999999999*************************************************************9 PP

                                     XXXX CS
                           START 201 qrqc 204
                                     ++ +
  Zpz_sc00537.1.g00220.1.am.mkhc 315 RHIR 318
                                     9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-181486IPR009057Homeodomain-like
PROSITE profilePS5007115.4352387IPR001356Homeobox domain
SMARTSM003892.6E-152591IPR001356Homeobox domain
SuperFamilySSF466895.13E-172790IPR009057Homeodomain-like
CDDcd000861.92E-162888No hitNo description
PfamPF000463.7E-162986IPR001356Homeobox domain
CDDcd146862.96E-680119No hitNo description
SuperFamilySSF559615.04E-18177321No hitNo description
PfamPF018521.6E-6177235IPR002913START domain
PROSITE profilePS5084812.499236301IPR002913START domain
PfamPF018526.7E-20236318IPR002913START domain
Gene3DG3DSA:3.30.530.202.8E-7240290IPR023393START-like domain
PfamPF086705.9E-27556654IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MAAMVAAGGG KDRSSPGGGG APQVDTGKYV RYTPEQVEAL ERVYSECPKP SSLRRQQLIR  60
ECPILSNIEP KQIKVWFQNR RCREKQRKEA SRLQTVNRKL TAMNKLLMEE NDRLQKQVSR  120
LVYENGYMKQ QLHNPSVATT DTSCDSVVTS GQHHQQQNPA APRPLRDANN PAGLLAIAEE  180
TLAEFLSKAT GTAVDWVQMV GMKPGPDSIG IIAVSHNCSG VAARACGLVS LEPTKICERS  240
LTQSTGGPSG PNTPNFVRAE VLPSGYLIRP CEGGGSMIHI VDHVDLDAWS VPEVLRPLYE  300
SPKILAQKMT IAALRHIRQI AHESSGEMPY GGGRQPAVLR TFSQRLSRFN VPPALLVRFL  360
REHRSEWADP GVDAYSAAAL RASPYAVPGP RASGFMGSQV ILPLAHTLEH EELCSGVDEN  420
AAGACAQLVF APIDESFADD APLLPSGFRV IPLDAKTDPP SGTRTLDLAS TLEVGSGGTT  480
RASSDASSTS STRSVLTIAF QFSYENHLRE SVAAMARQYV RTVVASVQRL AMAIAPSRIG  540
GQLEMKQTPG SPEAQTLARW IGRSYRFHTG AELLRTETPC TDSSLKALWQ HSDSIMCCSL  600
KAAPVFTFAN QAGLDMLETT LIALQDISLE KILDEDGRKA LCSEYPKIMQ QACTNHRYF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1032840.0AK103284.1 Oryza sativa Japonica Group cDNA clone:J033124M18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010920422.10.0PREDICTED: homeobox-leucine zipper protein HOX9 isoform X2
SwissprotQ6AST10.0HOX32_ORYSJ; Homeobox-leucine zipper protein HOX32
TrEMBLM0SZN20.0M0SZN2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P18530_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3734923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60690.11e-170HD-ZIP family protein